Order by 3PM for Same-Day Dispatch · Free Shipping · Rated Excellent ★ on Trustpilot
Retatrutide 10mg
£45.00
Order by 3pm on a working day for same-day dispatch
Low stock: 1 day's worth based on demand
100% of orders reach Royal Mail by the time we promised — the 30 days to 28 Sep
Better value in 30mg
Same peptide. Bigger size. Less per mg.
One 30mg vial is £90 — 3×10mg vials would be £135 for the same 30mg.
10mg£4.50/mg
30mg£3.00/mg
You save£45
That is one 30mg vial, not 3 — reconstituted it stays in use 3× as long.
Secure checkout
Manufacturer tested
Same-day dispatch
Free delivery £15+
Manufacturer tested, every batch: HPLC & mass spec, >99% purity
Independent Janoshik reports on selected batches. See which batches →
Pay by Bank: instant & secure via your own banking app — no card details · Learn more
₿Pay with Bitcoin: 20% off your first Bitcoin order · 10% off every order after · Learn more
Spend & save:
£100 → 10% off · £250 → 15% off
Pay securely via Fena — FCA-regulated open banking. No card needed. Info here
Specifications
| Product Name | Retatrutide 10mg |
|---|---|
| Supplied | 1 vial containing 10 mg lyophilised peptide powder |
| CAS Number | 2381089-83-2 |
| Molecular Formula | C221H342N46O68 |
| Molecular Weight | 4730.9 g/mol |
| Peptide Sequence | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS-NH2 (Aib at 2 and 20; α-methyl-Leu at 13; Lys17 acylated with a C20 fatty diacid via γGlu–AEEA linker) |
| Purity | ≥98% (HPLC verified) |
| Appearance | White to off-white lyophilised powder |
Reviews
5 out of 5·11 reviews
M GVerified purchase30 Sep 2026
Great products and great quick helpful service
CarolineVerified purchase19 Sep 2026
Excellent service, super fast delivery. No issues at all. Will recommend!
Valery FomitchevVerified purchase15 Sep 2026
Great product at great price, will continue my research and will buy the products here. Highly recommend
Show all 11 reviews
Caroline MatthewsVerified purchase7 Sep 2026
Easy ordering and super fast delivery.
Neale HopkinsVerified purchase3 Sep 2026
Great product just what it says
Neale HopkinsVerified purchase3 Sep 2026
Great product just what it says
Neale HopkinsVerified purchase3 Sep 2026
Great product just what it says
Neale HopkinsVerified purchase3 Sep 2026
Great product just what it says
Neale HopkinsVerified purchase3 Sep 2026
Great product just what it says
paulbonser89Verified purchase27 Jul 2026
Good product, fast delivery and excellent communication! Highly recommended.
Tiago Meneses24 May 2026
Working well. Fast delivery. Payment with no complications.
Write a review
About this compound
The manufacturer tests every batch of our Retatrutide by HPLC and mass spectrometry, to >99% purity. Those certificates are confidential under our supply agreement, so we cannot share them. Separately, we send selected batches to Janoshik, an independent lab, and publish every report on our lab reports page. Not every batch has an independent report, and each report names the batch it covers.
Retatrutide is supplied as a lyophilised powder in a single sealed vial (10 mg). Prior to dispatch it is stored at −20°C. On receipt it can be kept in a refrigerator at 8°C or below, which will keep it stable for several months. For longer-term storage, keep it at −20°C, which allows storage for several years without affecting the compound’s structure or purity.
Yes. All UK orders are dispatched via Royal Mail 24-Hour Tracked & Recorded. Orders placed before 3pm are shipped the same day.
Retatrutide is also known as LY3437943 (Development code name), and Triple Agonist Peptide (GLP‑1/GIP/Glucagon).
Ordered
795 orders in the 30 days to 28 Sep
With Royal Mail
100% by the time we promised · median 18h 18m
Delivered
77% next working day · median 0.9 days in transit
From real orders in the 30 days to 28 Sep · nightly updates paused while we connect Royal Mail trackingSee full delivery stats →
The difference is measurable
Simply Peptides vs. typical UK suppliers
Most suppliers ask you to take their word for it. We publish the reports, the batch numbers and our real delivery times — so you don't have to.
| What matters | Simply Peptides | Typical UK suppliers |
|---|---|---|
| Purity testing | Selected, vetted manufacturers confirm ≥99% purity by HPLC and mass spectrometry, every batch | Self-reported purity, or one method quoted with no figure attached |
| Independent testing | Third-party Janoshik analysis on selected batches — every report published and verifiable | In-house or supplier-supplied paperwork you have no way to check |
| Storage before dispatch | Held at −20°C right up to the day it ships | Room-temperature shelf storage, or simply not stated |
| Dispatch | Order by 3pm on a working day and it is with Royal Mail the same day — 100% hit rate, measured | “Same-day dispatch” claimed, with nothing published to back it |
| Delivery performance | Published and rebuilt nightly from every single order — 77% arrive the next working day | No delivery performance figures published at all |
| Delivery cost | Free Royal Mail Tracked 24 over £20, tracked from dispatch to the door | A shipping fee on every order, however much you spend |
Purity testing
Simply PeptidesSelected, vetted manufacturers confirm ≥99% purity by HPLC and mass spectrometry, every batch
Typical suppliersSelf-reported purity, or one method quoted with no figure attached
Independent testing
Simply PeptidesThird-party Janoshik analysis on selected batches — every report published and verifiable
Typical suppliersIn-house or supplier-supplied paperwork you have no way to check
Storage before dispatch
Simply PeptidesHeld at −20°C right up to the day it ships
Typical suppliersRoom-temperature shelf storage, or simply not stated
Dispatch
Simply PeptidesOrder by 3pm on a working day and it is with Royal Mail the same day — 100% hit rate, measured
Typical suppliers“Same-day dispatch” claimed, with nothing published to back it
Delivery performance
Simply PeptidesPublished and rebuilt nightly from every single order — 77% arrive the next working day
Typical suppliersNo delivery performance figures published at all
Delivery cost
Simply PeptidesFree Royal Mail Tracked 24 over £20, tracked from dispatch to the door
Typical suppliersA shipping fee on every order, however much you spend
Legal & safety: Simply Peptides supplies Retatrutide strictly for in vitro research use only. Not intended for human consumption, veterinary or clinical use. Not a supplement, drug or food product. Not evaluated by the MHRA.