Order by 3PM for Same-Day Dispatch · Free Shipping · Rated Excellent ★ on Trustpilot
Retatrutide 30mg
£90.00
Order by 3pm on a working day for same-day dispatch
In stock
100% of orders reach Royal Mail by the time we promised — the 30 days to 28 Sep
Secure checkout
Manufacturer tested
Same-day dispatch
Free delivery £15+
Manufacturer tested, every batch: HPLC & mass spec, >99% purity
Independent Janoshik reports on selected batches. See which batches →
Pay by Bank: instant & secure via your own banking app — no card details · Learn more
₿Pay with Bitcoin: 20% off your first Bitcoin order · 10% off every order after · Learn more
Spend & save:
£100 → 10% off · £250 → 15% off
Pay securely via Fena — FCA-regulated open banking. No card needed. Info here
Specifications
| Product Name | Retatrutide 30mg |
|---|---|
| Supplied | 1 vial containing 30 mg lyophilised peptide powder |
| CAS Number | 2381089-83-2 |
| Molecular Formula | C221H342N46O68 |
| Molecular Weight | 4730.9 g/mol |
| Peptide Sequence | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS-NH2 (Aib at 2 and 20; α-methyl-Leu at 13; Lys17 acylated with a C20 fatty diacid via γGlu–AEEA linker) |
| Purity | ≥98% (HPLC verified) |
| Appearance | White to off-white lyophilised powder |
Reviews
5 out of 5·9 reviews
MVerified purchase1 Oct 2026
Very good product and price fast delivery
Valeri FomitchevVerified purchase18 Sep 2026
What could be better than great product? Product with 30% discount!
David AgnewVerified purchase16 Sep 2026
Absolutely best company to order retatrutide from, others are artificially high with questionable quality
Show all 9 reviews
Charlotte12 Sep 2026
Great item and fast delivery have purchased from simply peptides a few times now and will be continuing to purchase from them .
hannahpalmer_07Verified purchase8 Sep 2026
Quality of product is exceptional and at the best price. I will be a returning customer. Thank you.
AMANDA KELLYVerified purchase29 Aug 2026
rachel2briggsVerified purchase21 Aug 2026
The wrong item was sent by mistake 10mg instead of 30mg. However after a quick message the right item was immediately sent and I received the following day. Very good customer service.
rachel2briggsVerified purchase21 Aug 2026
Perfect service. Would definitely buy again.
Valeri FomitchevVerified purchase14 Aug 2026
If anything this product works too well. And the price is right too. Will continue my shopping here.
Write a review
About this compound
The manufacturer tests every batch of our Retatrutide by HPLC and mass spectrometry, to ≥98% purity. Those certificates are confidential under our supply agreement, so we cannot share them. Separately, we send selected batches to Janoshik, an independent lab, and publish every report on our lab reports page. Not every batch has an independent report, and each report names the batch it covers.
Retatrutide is supplied as a lyophilised powder in a single sealed vial (30 mg). Prior to dispatch it is stored at −20°C. On receipt it can be kept in a refrigerator at 8°C or below, which will keep it stable for several months. For longer-term storage, keep it at −20°C, which allows storage for several years without affecting the compound’s structure or purity.
Yes. All UK orders are dispatched via Royal Mail 24-Hour Tracked & Recorded. Orders placed before 3pm are shipped the same day.
Retatrutide is also known as LY3437943 (Eli Lilly development code), GGG tri-agonist (receptor-class shorthand), and GLP-1/GIP/Glucagon triple agonist (functional descriptor).
Ordered
795 orders in the 30 days to 28 Sep
With Royal Mail
100% by the time we promised · median 18h 18m
Delivered
77% next working day · median 0.9 days in transit
From real orders in the 30 days to 28 Sep · nightly updates paused while we connect Royal Mail trackingSee full delivery stats →
The difference is measurable
Simply Peptides vs. typical UK suppliers
Most suppliers ask you to take their word for it. We publish the reports, the batch numbers and our real delivery times — so you don't have to.
| What matters | Simply Peptides | Typical UK suppliers |
|---|---|---|
| Purity testing | Selected, vetted manufacturers confirm ≥99% purity by HPLC and mass spectrometry, every batch | Self-reported purity, or one method quoted with no figure attached |
| Independent testing | Third-party Janoshik analysis on selected batches — every report published and verifiable | In-house or supplier-supplied paperwork you have no way to check |
| Storage before dispatch | Held at −20°C right up to the day it ships | Room-temperature shelf storage, or simply not stated |
| Dispatch | Order by 3pm on a working day and it is with Royal Mail the same day — 100% hit rate, measured | “Same-day dispatch” claimed, with nothing published to back it |
| Delivery performance | Published and rebuilt nightly from every single order — 77% arrive the next working day | No delivery performance figures published at all |
| Delivery cost | Free Royal Mail Tracked 24 over £20, tracked from dispatch to the door | A shipping fee on every order, however much you spend |
Purity testing
Simply PeptidesSelected, vetted manufacturers confirm ≥99% purity by HPLC and mass spectrometry, every batch
Typical suppliersSelf-reported purity, or one method quoted with no figure attached
Independent testing
Simply PeptidesThird-party Janoshik analysis on selected batches — every report published and verifiable
Typical suppliersIn-house or supplier-supplied paperwork you have no way to check
Storage before dispatch
Simply PeptidesHeld at −20°C right up to the day it ships
Typical suppliersRoom-temperature shelf storage, or simply not stated
Dispatch
Simply PeptidesOrder by 3pm on a working day and it is with Royal Mail the same day — 100% hit rate, measured
Typical suppliers“Same-day dispatch” claimed, with nothing published to back it
Delivery performance
Simply PeptidesPublished and rebuilt nightly from every single order — 77% arrive the next working day
Typical suppliersNo delivery performance figures published at all
Delivery cost
Simply PeptidesFree Royal Mail Tracked 24 over £20, tracked from dispatch to the door
Typical suppliersA shipping fee on every order, however much you spend
Legal & safety: Simply Peptides supplies Retatrutide strictly for in vitro research use only. Not intended for human consumption, veterinary or clinical use. Not a supplement, drug or food product. Not evaluated by the MHRA.